KCTD11 Blocking Peptide (33R-1090)

A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD11 antibody, catalog no. 70R-1493

Synonyms KCTD11 control peptide, KCTD11 antibody Blocking Peptide, Anti-KCTD11 Blocking Peptide, Potassium Channel Tetramerisation Domain Containing 11 Blocking Peptide, KCTD11, KCTD-11, KCTD 11, KCTD-11 Blocking Peptide, KCTD 11 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH
Molecular Weight 26 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The KCTD11 gene encodes a protein that has been identified as a suppressor of Hedgehog signaling. Its inactivation might lead to a deregulation of the tumor-promoting Hedgehog pathway in medulloblastoma.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors