KCTD11 Blocking Peptide (33R-1090)
A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD11 antibody, catalog no. 70R-1493
Overview
Overview
| Synonyms | KCTD11 control peptide, KCTD11 antibody Blocking Peptide, Anti-KCTD11 Blocking Peptide, Potassium Channel Tetramerisation Domain Containing 11 Blocking Peptide, KCTD11, KCTD-11, KCTD 11, KCTD-11 Blocking Peptide, KCTD 11 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH |
|---|---|
| Molecular Weight | 26 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The KCTD11 gene encodes a protein that has been identified as a suppressor of Hedgehog signaling. Its inactivation might lead to a deregulation of the tumor-promoting Hedgehog pathway in medulloblastoma. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product