KCTD16 antibody (70R-3962)

Rabbit polyclonal KCTD16 antibody raised against the N terminal of KCTD16

Synonyms Polyclonal KCTD16 antibody, Anti-KCTD16 antibody, DKFZp781A1155 antibody, KCTD-16, KCTD 16, Potassium Channel Tetramerisation Domain Containing 16 antibody, KCTD16, MGC138167 antibody, KCTD-16 antibody, KIAA1317 antibody, KCTD 16 antibody
Specificity KCTD16 antibody was raised against the N terminal of KCTD16
Cross Reactivity Human
Applications WB
Immunogen KCTD16 antibody was raised using the N terminal of KCTD16 corresponding to a region with amino acids KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL
Assay Information KCTD16 Blocking Peptide, catalog no. 33R-4621, is also available for use as a blocking control in assays to test for specificity of this KCTD16 antibody

Images

Western Blot analysis using KCTD16 antibody (70R-3962)

KCTD16 antibody (70R-3962) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCTD16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCTD16 is an auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. It increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCTD16 antibody (70R-3962) | KCTD16 antibody (70R-3962) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors