KHDRBS2 antibody (70R-3227)

Rabbit polyclonal KHDRBS2 antibody raised against the middle region of KHDRBS2

Synonyms Polyclonal KHDRBS2 antibody, Anti-KHDRBS2 antibody, MGC26664 antibody, KHDRBS-2 antibody, SLM1 antibody, KHDRBS 2 antibody, Kh Domain Containing Rna Binding Signal Transduction Associated 2 antibody, KHDRBS 2, KHDRBS2, KHDRBS-2, FLJ38664 antibody, bA535F17.1 antibody, SLM-1 antibody
Specificity KHDRBS2 antibody was raised against the middle region of KHDRBS2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KHDRBS2 antibody was raised using the middle region of KHDRBS2 corresponding to a region with amino acids EAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRG
Assay Information KHDRBS2 Blocking Peptide, catalog no. 33R-2292, is also available for use as a blocking control in assays to test for specificity of this KHDRBS2 antibody

Images

Western Blot analysis using KHDRBS2 antibody (70R-3227)

KHDRBS2 antibody (70R-3227) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KHDRBS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KHDRBS2 is a RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. Its phosphorylation by FYN inhibits its ability to regulate splice site selection.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KHDRBS2 antibody (70R-3227) | KHDRBS2 antibody (70R-3227) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors