KIAA0020 antibody (70R-4938)

Rabbit polyclonal KIAA0020 antibody raised against the middle region of KIAA0020

Synonyms Polyclonal KIAA0020 antibody, Anti-KIAA0020 antibody, Kiaa0020 antibody, KIAA00-20, KIAA00-20 antibody, PEN antibody, KIAA00 20, MGC8749 antibody, HLA-HA8 antibody, XTP5 antibody, PUF6 antibody, KIAA00 20 antibody, KIAA0020
Specificity KIAA0020 antibody was raised against the middle region of KIAA0020
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KIAA0020 antibody was raised using the middle region of KIAA0020 corresponding to a region with amino acids PAHTVREIIEVLQKGDGNAHSKKDTEVRRRELLESISPALLSYLQEHAQE
Assay Information KIAA0020 Blocking Peptide, catalog no. 33R-6960, is also available for use as a blocking control in assays to test for specificity of this KIAA0020 antibody

Images

Western Blot analysis using KIAA0020 antibody (70R-4938)

KIAA0020 antibody (70R-4938) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0020 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIAA0020 contains 6 pumilio repeats and 1PUM-HD domain. The function remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIAA0020 antibody (70R-4938) | KIAA0020 antibody (70R-4938) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors