KIAA0319 antibody (70R-1738)

Rabbit polyclonal KIAA0319 antibody raised against the N terminal of KIAA0319

Synonyms Polyclonal KIAA0319 antibody, Anti-KIAA0319 antibody, KIAA0319, Kiaa0319 antibody, KIAA0-319, KIAA0-319 antibody, DLX2 antibody, DYLX2 antibody, KIAA0 319, KIAA0 319 antibody, MGC176717 antibody, DYX2 antibody
Specificity KIAA0319 antibody was raised against the N terminal of KIAA0319
Cross Reactivity Human
Applications IHC, WB
Immunogen KIAA0319 antibody was raised using the N terminal of KIAA0319 corresponding to a region with amino acids EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG
Assay Information KIAA0319 Blocking Peptide, catalog no. 33R-2376, is also available for use as a blocking control in assays to test for specificity of this KIAA0319 antibody


Immunohistochemical staining using KIAA0319 antibody (70R-1738)

KIAA0319 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KIAA0319 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIAA0319 has been strongly associated with developmental dyslexia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using KIAA0319 antibody (70R-1738) | KIAA0319 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using KIAA0319 antibody (70R-1738) | KIAA0319 antibody (70R-1738) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using KIAA0319 antibody (70R-1738) | KIAA0319 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors