KIAA0427 antibody (70R-4855)

Rabbit polyclonal KIAA0427 antibody raised against the N terminal of KIAA0427

Synonyms Polyclonal KIAA0427 antibody, Anti-KIAA0427 antibody, KIAA0 427, Gm672 antibody, KIAA0-427 antibody, KIAA0427, KIAA0-427, KIAA0 427 antibody, Kiaa0427 antibody
Specificity KIAA0427 antibody was raised against the N terminal of KIAA0427
Cross Reactivity Human
Applications WB
Immunogen KIAA0427 antibody was raised using the N terminal of KIAA0427 corresponding to a region with amino acids QVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQN
Assay Information KIAA0427 Blocking Peptide, catalog no. 33R-7783, is also available for use as a blocking control in assays to test for specificity of this KIAA0427 antibody


Western Blot analysis using KIAA0427 antibody (70R-4855)

KIAA0427 antibody (70R-4855) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0427 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CTIF is a component of the CBP80/CBP20 translation initiation complex that binds cotranscriptionally to the cap end of nascent mRNA. The CBP80/CBP20 complex is involved in a simultaneous editing and translation step that recognises premature termination codons in mRNAs and directs PTC-containing mRNAs toward nonsense-mediated decay. On mRNAs without PTCs, the CBP80/CBP20 complex is replaced with cytoplasmic mRNA cap-binding proteins, including EIF4G, and steady-state translation of the mRNAs resumes in the cytoplasm.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIAA0427 antibody (70R-4855) | KIAA0427 antibody (70R-4855) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors