KIAA0427 Blocking Peptide (33R-7783)

A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0427 antibody, catalog no. 70R-4855

Synonyms KIAA0427 control peptide, KIAA0427 antibody Blocking Peptide, Anti-KIAA0427 Blocking Peptide, Kiaa0427 Blocking Peptide, Gm672 Blocking Peptide, KIAA0427, KIAA0-427, KIAA0 427, KIAA0-427 Blocking Peptide, KIAA0 427 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQN
Molecular Weight 67 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CTIF is a component of the CBP80/CBP20 translation initiation complex that binds cotranscriptionally to the cap end of nascent mRNA. The CBP80/CBP20 complex is involved in a simultaneous editing and translation step that recognises premature termination codons in mRNAs and directs PTC-containing mRNAs toward nonsense-mediated decay. On mRNAs without PTCs, the CBP80/CBP20 complex is replaced with cytoplasmic mRNA cap-binding proteins, including EIF4G, and steady-state translation of the mRNAs resumes in the cytoplasm.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors