KIAA0427 Blocking Peptide (33R-7783)
A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0427 antibody, catalog no. 70R-4855
Overview
Overview
| Synonyms | KIAA0427 control peptide, KIAA0427 antibody Blocking Peptide, Anti-KIAA0427 Blocking Peptide, Kiaa0427 Blocking Peptide, Gm672 Blocking Peptide, KIAA0427, KIAA0-427, KIAA0 427, KIAA0-427 Blocking Peptide, KIAA0 427 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQN |
|---|---|
| Molecular Weight | 67 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CTIF is a component of the CBP80/CBP20 translation initiation complex that binds cotranscriptionally to the cap end of nascent mRNA. The CBP80/CBP20 complex is involved in a simultaneous editing and translation step that recognises premature termination codons in mRNAs and directs PTC-containing mRNAs toward nonsense-mediated decay. On mRNAs without PTCs, the CBP80/CBP20 complex is replaced with cytoplasmic mRNA cap-binding proteins, including EIF4G, and steady-state translation of the mRNAs resumes in the cytoplasm. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product