KIAA0859 antibody (70R-1272)

Rabbit polyclonal KIAA0859 antibody raised against the C terminal of KIAA0859

Synonyms Polyclonal KIAA0859 antibody, Anti-KIAA0859 antibody, FLJ10310 antibody, KIAA-859 antibody, CGI-01 antibody, Kiaa0859 antibody, KIAA0859, 5630401D24Rik antibody, KIAA-859, KIAA 0859 antibody, KIAA 0859
Specificity KIAA0859 antibody was raised against the C terminal of KIAA0859
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KIAA0859 antibody was raised using the C terminal of KIAA0859 corresponding to a region with amino acids NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV
Assay Information KIAA0859 Blocking Peptide, catalog no. 33R-6670, is also available for use as a blocking control in assays to test for specificity of this KIAA0859 antibody


Western Blot analysis using KIAA0859 antibody (70R-1272)

KIAA0859 antibody (70R-1272) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KIAA0859 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of KIAA0859 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIAA0859 antibody (70R-1272) | KIAA0859 antibody (70R-1272) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors