KIAA1191 antibody (70R-4448)

Rabbit polyclonal KIAA1191 antibody raised against the middle region of KIAA1191

Synonyms Polyclonal KIAA1191 antibody, Anti-KIAA1191 antibody, Kiaa1191 antibody, KIAA-1191, KIAA 1191, KIAA1191, FLJ21022 antibody, KIAA 1191 antibody, KIAA-1191 antibody
Specificity KIAA1191 antibody was raised against the middle region of KIAA1191
Cross Reactivity Human
Applications WB
Immunogen KIAA1191 antibody was raised using the middle region of KIAA1191 corresponding to a region with amino acids TKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWF
Assay Information KIAA1191 Blocking Peptide, catalog no. 33R-9155, is also available for use as a blocking control in assays to test for specificity of this KIAA1191 antibody


Western Blot analysis using KIAA1191 antibody (70R-4448)

KIAA1191 antibody (70R-4448) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA1191 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of KIAA1191 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIAA1191 antibody (70R-4448) | KIAA1191 antibody (70R-4448) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors