KIAA1958 Blocking Peptide (33R-8678)
A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1958 antibody, catalog no. 70R-4141
Overview
Overview
| Synonyms | KIAA1958 control peptide, KIAA1958 antibody Blocking Peptide, Anti-KIAA1958 Blocking Peptide, Kiaa1958 Blocking Peptide, RP11-276E15.5 Blocking Peptide, FLJ39294 Blocking Peptide, MGC142075 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SPITLLSTVVKYNSQYLNMRTLQEHADLMYGDIELLKDPQNQPYFARTDS |
|---|---|
| Molecular Weight | 62 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of KIAA1958 protein has not been widely studied, and is yet to be fully elucidated. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product