KIF1C antibody (70R-1611)

Rabbit polyclonal KIF1C antibody raised against the C terminal of KIF1C

Synonyms Polyclonal KIF1C antibody, Anti-KIF1C antibody, KIFC 1, KIFC 1 antibody, KIF1C, Kinesin Family Member 1C antibody, KIFC-1, KIFC-1 antibody
Specificity KIF1C antibody was raised against the C terminal of KIF1C
Cross Reactivity Human,Dog
Applications WB
Immunogen KIF1C antibody was raised using the C terminal of KIF1C corresponding to a region with amino acids GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPP
Assay Information KIF1C Blocking Peptide, catalog no. 33R-3283, is also available for use as a blocking control in assays to test for specificity of this KIF1C antibody


Western Blot analysis using KIF1C antibody (70R-1611)

KIF1C antibody (70R-1611) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 123 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KIF1C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF1C represents a member of the Unc104 subfamily of kinesin-like proteins that are involved in the transport of mitochondria or synaptic vesicles in axons. KIF1C consists of an amino-terminal motor domain followed by a U104 domain and probably binds to target membranes through carboxyl-terminal sequences.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIF1C antibody (70R-1611) | KIF1C antibody (70R-1611) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors