KIF23 antibody (70R-1608)

Rabbit polyclonal KIF23 antibody raised against the N terminal of KIF23

Synonyms Polyclonal KIF23 antibody, Anti-KIF23 antibody, Kinesin Family Member 23 antibody, KIF-23, KIF23, KIF 23, KIF-23 antibody, KIF 23 antibody
Specificity KIF23 antibody was raised against the N terminal of KIF23
Cross Reactivity Human
Applications WB
Immunogen KIF23 antibody was raised using the N terminal of KIF23 corresponding to a region with amino acids MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNT
Assay Information KIF23 Blocking Peptide, catalog no. 33R-6166, is also available for use as a blocking control in assays to test for specificity of this KIF23 antibody

Images

Western Blot analysis using KIF23 antibody (70R-1608)

KIF23 antibody (70R-1608) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KIF23 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIF23 antibody (70R-1608) | KIF23 antibody (70R-1608) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors