KIF25 antibody (70R-1615)

Rabbit polyclonal KIF25 antibody raised against the C terminal of KIF25

Synonyms Polyclonal KIF25 antibody, Anti-KIF25 antibody, KIF 25, KIF25, KIF-25, KIF-25 antibody, Kinesin Family Member 25 antibody, KIF 25 antibody
Specificity KIF25 antibody was raised against the C terminal of KIF25
Cross Reactivity Human
Applications IHC, WB
Immunogen KIF25 antibody was raised using the C terminal of KIF25 corresponding to a region with amino acids VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTL
Assay Information KIF25 Blocking Peptide, catalog no. 33R-9657, is also available for use as a blocking control in assays to test for specificity of this KIF25 antibody

Images

Western Blot analysis using KIF25 antibody (70R-1615)

KIF25 antibody (70R-1615) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KIF25 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by the KIF25 gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. However, the particular function of this gene product has not yet been determined. Two alternatively spliced transcript variants which encode products have been described. Other splice variants have been found that lack exon 2 and the initiation codon for translation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIF25 antibody (70R-1615) | KIF25 antibody (70R-1615) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors