KIF3B antibody (70R-5560)

Rabbit polyclonal KIF3B antibody raised against the C terminal of KIF3B

Synonyms Polyclonal KIF3B antibody, Anti-KIF3B antibody, KIFB 3 antibody, KIFB-3 antibody, KIFB 3, KIFB-3, Kinesin Family Member 3B antibody, KIF3B
Specificity KIF3B antibody was raised against the C terminal of KIF3B
Cross Reactivity Human
Applications WB
Immunogen KIF3B antibody was raised using the C terminal of KIF3B corresponding to a region with amino acids APKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSGRKSGSSSSSS
Assay Information KIF3B Blocking Peptide, catalog no. 33R-1426, is also available for use as a blocking control in assays to test for specificity of this KIF3B antibody

Images

Western Blot analysis using KIF3B antibody (70R-5560)

KIF3B antibody (70R-5560) used at 2 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 85 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF3B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by the KIF3B gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved in the intracellular movement of membranous organelles. This protein and kinesin family member 3A form the kinesin II subfamily of the kinesin superfamily.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIF3B antibody (70R-5560) | KIF3B antibody (70R-5560) used at 2 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors