KIF5C antibody (70R-3790)

Rabbit polyclonal KIF5C antibody raised against the N terminal of KIF5C

Synonyms Polyclonal KIF5C antibody, Anti-KIF5C antibody, MGC111478 antibody, NKHC antibody, KINN antibody, KIF5C, KIAA0531 antibody, NKHC2 antibody, NKHC-2 antibody, KIFC 5 antibody, Kinesin Family Member 5C antibody, KIFC-5, KIFC-5 antibody, FLJ44735 antibody, KIFC 5
Specificity KIF5C antibody was raised against the N terminal of KIF5C
Cross Reactivity Human
Applications WB
Immunogen KIF5C antibody was raised using the N terminal of KIF5C corresponding to a region with amino acids ADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDR
Assay Information KIF5C Blocking Peptide, catalog no. 33R-1099, is also available for use as a blocking control in assays to test for specificity of this KIF5C antibody


Western Blot analysis using KIF5C antibody (70R-3790)

KIF5C antibody (70R-3790) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 109 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF5C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF5C belongs to the kinesin-like protein family, Kinesin subfamily. It contains 1 kinesin-motor domain. Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIF5C antibody (70R-3790) | KIF5C antibody (70R-3790) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors