KIF5C Blocking Peptide (33R-1099)
A synthetic peptide for use as a blocking control in assays to test for specificity of KIF5C antibody, catalog no. 70R-3790
Overview
Overview
| Synonyms | KIF5C control peptide, KIF5C antibody Blocking Peptide, Anti-KIF5C Blocking Peptide, Kinesin Family Member 5C Blocking Peptide, FLJ44735 Blocking Peptide, KIAA0531 Blocking Peptide, KINN Blocking Peptide, MGC111478 Blocking Peptide, NKHC Blocking Peptide, NKHC-2 Blocking Peptide, NKHC2 Blocking Peptide, KIF5C, KIFC-5, KIFC 5, KIFC-5 Blocking Peptide, KIFC 5 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | ADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDR |
|---|---|
| Molecular Weight | 109 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | KIF5C belongs to the kinesin-like protein family, Kinesin subfamily. It contains 1 kinesin-motor domain. Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product