KIF5C Blocking Peptide (33R-1099)

A synthetic peptide for use as a blocking control in assays to test for specificity of KIF5C antibody, catalog no. 70R-3790

Synonyms KIF5C control peptide, KIF5C antibody Blocking Peptide, Anti-KIF5C Blocking Peptide, Kinesin Family Member 5C Blocking Peptide, FLJ44735 Blocking Peptide, KIAA0531 Blocking Peptide, KINN Blocking Peptide, MGC111478 Blocking Peptide, NKHC Blocking Peptide, NKHC-2 Blocking Peptide, NKHC2 Blocking Peptide, KIF5C, KIFC-5, KIFC 5, KIFC-5 Blocking Peptide, KIFC 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDR
Molecular Weight 109 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF5C belongs to the kinesin-like protein family, Kinesin subfamily. It contains 1 kinesin-motor domain. Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors