KIF9 antibody (70R-5603)

Rabbit polyclonal KIF9 antibody raised against the n terminal of KIF9

Synonyms Polyclonal KIF9 antibody, Anti-KIF9 antibody, KIF 9 antibody, KIF9, KIF-9, KIF 9, KIF-9 antibody, MGC104186 antibody, Kinesin Family Member 9 antibody
Specificity KIF9 antibody was raised against the n terminal of KIF9
Cross Reactivity Human
Applications WB
Immunogen KIF9 antibody was raised using the N terminal of KIF9 corresponding to a region with amino acids MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQ
Assay Information KIF9 Blocking Peptide, catalog no. 33R-6084, is also available for use as a blocking control in assays to test for specificity of this KIF9 antibody


Western Blot analysis using KIF9 antibody (70R-5603)

KIF9 antibody (70R-5603) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 75 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF9 acts as a regulator of podosomes and of podosomal matrix degradation in primary human macrophages.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIF9 antibody (70R-5603) | KIF9 antibody (70R-5603) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors