KIR2DL4 Blocking Peptide (33R-9831)

A synthetic peptide for use as a blocking control in assays to test for specificity of KIR2DL4 antibody, catalog no. 70R-2365

Synonyms KIR2DL4 control peptide, KIR2DL4 antibody Blocking Peptide, Anti-KIR2DL4 Blocking Peptide, Killer Cell Immunoglobulin-Like Receptor Two Domains Long Cytoplasmic Tail 4 Blocking Peptide, CD158D Blocking Peptide, G9P Blocking Peptide, KIR103 Blocking Peptide, KIR103AS Blocking Peptide, KIR2DL4, KIRDL4-2, KIRDL4 2, KIRDL4-2 Blocking Peptide, KIRDL4 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR
Molecular Weight 30 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors