KIR2DL4 Blocking Peptide (33R-9831)
A synthetic peptide for use as a blocking control in assays to test for specificity of KIR2DL4 antibody, catalog no. 70R-2365
Overview
Overview
| Synonyms | KIR2DL4 control peptide, KIR2DL4 antibody Blocking Peptide, Anti-KIR2DL4 Blocking Peptide, Killer Cell Immunoglobulin-Like Receptor Two Domains Long Cytoplasmic Tail 4 Blocking Peptide, CD158D Blocking Peptide, G9P Blocking Peptide, KIR103 Blocking Peptide, KIR103AS Blocking Peptide, KIR2DL4, KIRDL4-2, KIRDL4 2, KIRDL4-2 Blocking Peptide, KIRDL4 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR |
|---|---|
| Molecular Weight | 30 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product