KLC3 antibody (70R-2517)

Rabbit polyclonal KLC3 antibody raised against the middle region of KLC3

Synonyms Polyclonal KLC3 antibody, Anti-KLC3 antibody, KLCt antibody, KLC2L antibody, KLC2 antibody, Kinesin Light Chain 3 antibody, KNS2B antibody
Specificity KLC3 antibody was raised against the middle region of KLC3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KLC3 antibody was raised using the middle region of KLC3 corresponding to a region with amino acids MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL
Assay Information KLC3 Blocking Peptide, catalog no. 33R-6199, is also available for use as a blocking control in assays to test for specificity of this KLC3 antibody


Western Blot analysis using KLC3 antibody (70R-2517)

KLC3 antibody (70R-2517) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KLC3 is a member of the kinesin light chain gene family. Kinesins are molecular motors involved in the transport of cargo along microtubules, and are composed of two kinesin heavy chain (KHC) and two kinesin light chain (KLC) molecules. KLCs are thought to typically be involved in binding cargo and regulating kinesin activity. In the rat, a protein similar to this gene product is expressed in post-meiotic spermatids, where it associates with structural components of sperm tails and mitochondria.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KLC3 antibody (70R-2517) | KLC3 antibody (70R-2517) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors