KLHDC8B antibody (70R-3670)

Rabbit polyclonal KLHDC8B antibody raised against the N terminal of KLHDC8B

Synonyms Polyclonal KLHDC8B antibody, Anti-KLHDC8B antibody, KLHDC8B, KLHDCB 8, MGC35097 antibody, FLJ11302 antibody, Kelch Domain Containing 8B antibody, KLHDCB-8 antibody, KLHDCB 8 antibody, KLHDCB-8
Specificity KLHDC8B antibody was raised against the N terminal of KLHDC8B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KLHDC8B antibody was raised using the N terminal of KLHDC8B corresponding to a region with amino acids MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAE
Assay Information KLHDC8B Blocking Peptide, catalog no. 33R-6393, is also available for use as a blocking control in assays to test for specificity of this KLHDC8B antibody


Western Blot analysis using KLHDC8B antibody (70R-3670)

KLHDC8B antibody (70R-3670) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLHDC8B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KLHDC8B contains 8 Kelch repeats. The exact function of KLHDC8B remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KLHDC8B antibody (70R-3670) | KLHDC8B antibody (70R-3670) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors