KLHDC9 antibody (70R-4006)

Rabbit polyclonal KLHDC9 antibody raised against the middle region of KLHDC9

Synonyms Polyclonal KLHDC9 antibody, Anti-KLHDC9 antibody, Kelch Domain Containing 9 antibody, MGC33338 antibody, KLHDC9, RP11-544M22.9 antibody, KLHDC 9, KARCA1 antibody, KLHDC-9, KLHDC 9 antibody, KLHDC-9 antibody
Specificity KLHDC9 antibody was raised against the middle region of KLHDC9
Cross Reactivity Human
Applications WB
Immunogen KLHDC9 antibody was raised using the middle region of KLHDC9 corresponding to a region with amino acids AEPEVAGHWSHGKIKEEPPVAPHLMEQLARLVSSGQGSQKGPHGLRHHSC
Assay Information KLHDC9 Blocking Peptide, catalog no. 33R-1143, is also available for use as a blocking control in assays to test for specificity of this KLHDC9 antibody


Western Blot analysis using KLHDC9 antibody (70R-4006)

KLHDC9 antibody (70R-4006) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLHDC9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of KLHDC9 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KLHDC9 antibody (70R-4006) | KLHDC9 antibody (70R-4006) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors