KLHL31 Blocking Peptide (33R-9231)
A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL31 antibody, catalog no. 70R-6296
Overview
Overview
| Synonyms | KLHL31 control peptide, KLHL31 antibody Blocking Peptide, Anti-KLHL31 Blocking Peptide, Kelch-Like 31 Blocking Peptide, BKLHD6 Blocking Peptide, KLHL Blocking Peptide, bA345L23.2 Blocking Peptide, KLHL31, KLHL-31, KLHL 31, KLHL-31 Blocking Peptide, KLHL 31 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP |
|---|---|
| Molecular Weight | 70 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | KLHL31 is a transcriptional repressor in MAPK/JNK signaling pathway to regulate cellular functions. Overexpression inhibits the transcriptional activities of both the TPA-response element (TRE) and serum response element (SRE) |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product