KLHL31 Blocking Peptide (33R-9231)

A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL31 antibody, catalog no. 70R-6296

Synonyms KLHL31 control peptide, KLHL31 antibody Blocking Peptide, Anti-KLHL31 Blocking Peptide, Kelch-Like 31 Blocking Peptide, BKLHD6 Blocking Peptide, KLHL Blocking Peptide, bA345L23.2 Blocking Peptide, KLHL31, KLHL-31, KLHL 31, KLHL-31 Blocking Peptide, KLHL 31 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP
Molecular Weight 70 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KLHL31 is a transcriptional repressor in MAPK/JNK signaling pathway to regulate cellular functions. Overexpression inhibits the transcriptional activities of both the TPA-response element (TRE) and serum response element (SRE)

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors