KLK-B1 antibody (70R-1656)

Rabbit polyclonal KLK-B1 antibody

Synonyms Polyclonal KLK-B1 antibody, Anti-KLK-B1 antibody, KLK-B 1, Kallikrein B Plasma antibody, KLK-B 1 antibody, KLK-B-1, KLKB1 antibody, KLK3 antibody, KLK-B-1 antibody, KLK-B1, Fletcher Factor 1 antibody
Cross Reactivity Human
Applications WB
Immunogen KLK-B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS
Assay Information KLK-B1 Blocking Peptide, catalog no. 33R-9688, is also available for use as a blocking control in assays to test for specificity of this KLK-B1 antibody

Images

Western Blot analysis using KLK-B1 antibody (70R-1656)

KLK-B1 antibody (70R-1656) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KLKB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Plasma prekallikrein is a glycoprotein that participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. It is synthesized in the liver and secreted into the blood as a single polypeptide chain. Plasma prekallikrein is converted to plasma kallikrein by factor XIIa by the cleavage of an internal Arg-Ile bond. Plasma prekallikrein deficiency causes a prolonged activated partial thromboplastin time in patients.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KLK-B1 antibody (70R-1656) | KLK-B1 antibody (70R-1656) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors