KLK-B1 Blocking Peptide (33R-9688)

A synthetic peptide for use as a blocking control in assays to test for specificity of KLKB1 antibody, catalog no. 70R-1656

Synonyms KLK-B1 control peptide, KLK-B1 antibody Blocking Peptide, Anti-KLK-B1 Blocking Peptide, KLKB1 Blocking Peptide, Kallikrein B Plasma Blocking Peptide, Fletcher Factor 1 Blocking Peptide, KLK3 Blocking Peptide, KLK-B1, KLK-B-1, KLK-B 1, KLK-B-1 Blocking Peptide, KLK-B 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS
Molecular Weight 28 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Plasma prekallikrein is a glycoprotein that participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. It is synthesized in the liver and secreted into the blood as a single polypeptide chain. Plasma prekallikrein is converted to plasma kallikrein by factor XIIa by the cleavage of an internal Arg-Ile bond. Plasma prekallikrein deficiency causes a prolonged activated partial thromboplastin time in patients.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors