KLK-B1 Blocking Peptide (33R-9688)
A synthetic peptide for use as a blocking control in assays to test for specificity of KLKB1 antibody, catalog no. 70R-1656
Overview
Overview
| Synonyms | KLK-B1 control peptide, KLK-B1 antibody Blocking Peptide, Anti-KLK-B1 Blocking Peptide, KLKB1 Blocking Peptide, Kallikrein B Plasma Blocking Peptide, Fletcher Factor 1 Blocking Peptide, KLK3 Blocking Peptide, KLK-B1, KLK-B-1, KLK-B 1, KLK-B-1 Blocking Peptide, KLK-B 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS |
|---|---|
| Molecular Weight | 28 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Plasma prekallikrein is a glycoprotein that participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. It is synthesized in the liver and secreted into the blood as a single polypeptide chain. Plasma prekallikrein is converted to plasma kallikrein by factor XIIa by the cleavage of an internal Arg-Ile bond. Plasma prekallikrein deficiency causes a prolonged activated partial thromboplastin time in patients. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product