KLK13 Blocking Peptide (33R-9689)

A synthetic peptide for use as a blocking control in assays to test for specificity of KLK13 antibody, catalog no. 70R-3265

Synonyms KLK13 control peptide, KLK13 antibody Blocking Peptide, Anti-KLK13 Blocking Peptide, Kallikrein-Related Peptidase 13 Blocking Peptide, DKFZP586J1923 Blocking Peptide, KLK-L4 Blocking Peptide, KLKL4 Blocking Peptide, KLK13, KLK-13, KLK 13, KLK-13 Blocking Peptide, KLK 13 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN
Molecular Weight 29 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Expression of this gene is regulated by steroid hormones and may be useful as a marker for breast cancer. An additional transcript variant has been identified, but its full length sequence has not been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors