KRAS Blocking Peptide (33R-9058)
A synthetic peptide for use as a blocking control in assays to test for specificity of KRAS antibody, catalog no. 70R-5673
Overview
Overview
| Synonyms | KRAS control peptide, KRAS antibody Blocking Peptide, Anti-KRAS Blocking Peptide, V-Ki-Ras2 Kirsten Rat Sarcoma Viral Oncogene Homolog Blocking Peptide, C-K-RAS Blocking Peptide, K-RAS2A Blocking Peptide, K-RAS2B Blocking Peptide, K-RAS4A Blocking Peptide, K-RAS4B Blocking Peptide, KI-RAS Blocking Peptide, KRAS1 Blocking Peptide, KRAS2 Blocking Peptide, NS3 Blocking Peptide, RASK2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC |
|---|---|
| Molecular Weight | 22 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product