LAB Blocking Peptide (33R-6229)
A synthetic peptide for use as a blocking control in assays to test for specificity of lab antibody, catalog no. 70R-2191
Overview
Overview
| Synonyms | LAB control peptide, LAB antibody Blocking Peptide, Anti-LAB Blocking Peptide, Dmel_CG1264 Blocking Peptide, BG:DS00004.9 Blocking Peptide, CG1264 Blocking Peptide, DmLab Blocking Peptide, EfR9 Blocking Peptide, F121 Blocking Peptide, F24 Blocking Peptide, F90 Blocking Peptide, F90-2 Blocking Peptide, l(3)01241 Blocking Peptide, l(3)84Ac Blocking Peptide, lb Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL |
|---|---|
| Molecular Weight | 54 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product