LAB Blocking Peptide (33R-6229)

A synthetic peptide for use as a blocking control in assays to test for specificity of lab antibody, catalog no. 70R-2191

Synonyms LAB control peptide, LAB antibody Blocking Peptide, Anti-LAB Blocking Peptide, Dmel_CG1264 Blocking Peptide, BG:DS00004.9 Blocking Peptide, CG1264 Blocking Peptide, DmLab Blocking Peptide, EfR9 Blocking Peptide, F121 Blocking Peptide, F24 Blocking Peptide, F90 Blocking Peptide, F90-2 Blocking Peptide, l(3)01241 Blocking Peptide, l(3)84Ac Blocking Peptide, lb Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL
Molecular Weight 54 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors