Lamin B2 antibody (70R-2430)

Rabbit polyclonal Lamin B2 antibody raised against the middle region of LMNB2

Synonyms Polyclonal Lamin B2 antibody, Anti-Lamin B2 antibody, MGC2721 antibody, LAMB2 antibody, LMNB2 antibody, LMN2 antibody
Specificity Lamin B2 antibody was raised against the middle region of LMNB2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Lamin B2 antibody was raised using the middle region of LMNB2 corresponding to a region with amino acids EVAMRTVKKSSVMRENENGEEEEEEAEFGEEDLFHQQGDPRTTSRGCYVM
Assay Information Lamin B2 Blocking Peptide, catalog no. 33R-2775, is also available for use as a blocking control in assays to test for specificity of this Lamin B2 antibody


Western Blot analysis using Lamin B2 antibody (70R-2430)

Lamin B2 antibody (70R-2430) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LMNB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. LMNB2 is one of the two B type proteins, B2.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Lamin B2 antibody (70R-2430) | Lamin B2 antibody (70R-2430) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors