LAMP1 Blocking Peptide (33R-6801)
A synthetic peptide for use as a blocking control in assays to test for specificity of LAMP1 antibody, catalog no. 70R-9628
Overview
Overview
| Synonyms | LAMP1 control peptide, LAMP1 antibody Blocking Peptide, Anti-LAMP1 Blocking Peptide, lysosomal-associated membrane protein 1 Blocking Peptide, CD107a Blocking Peptide, LAMPA Blocking Peptide, LGP120 Blocking Peptide, LAMP1, LAMP-1, LAMP 1, LAMP-1 Blocking Peptide, LAMP 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRY |
|---|---|
| Molecular Weight | 39 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product