LAMP1 Blocking Peptide (33R-6801)

A synthetic peptide for use as a blocking control in assays to test for specificity of LAMP1 antibody, catalog no. 70R-9628

Synonyms LAMP1 control peptide, LAMP1 antibody Blocking Peptide, Anti-LAMP1 Blocking Peptide, lysosomal-associated membrane protein 1 Blocking Peptide, CD107a Blocking Peptide, LAMPA Blocking Peptide, LGP120 Blocking Peptide, LAMP1, LAMP-1, LAMP 1, LAMP-1 Blocking Peptide, LAMP 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRY
Molecular Weight 39 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors