LANCL2 antibody (70R-2713)

Rabbit polyclonal LANCL2 antibody

Synonyms Polyclonal LANCL2 antibody, Anti-LANCL2 antibody, GPR69B antibody, MGC87139 antibody, LANCL-2 antibody, LANCL2, LANCL 2 antibody, LANCL 2, Lanc Lantibiotic Synthetase Component C-Like 2 antibody, LANCL-2, TASP antibody
Cross Reactivity Human
Applications WB
Immunogen LANCL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVV
Assay Information LANCL2 Blocking Peptide, catalog no. 33R-5325, is also available for use as a blocking control in assays to test for specificity of this LANCL2 antibody


Western Blot analysis using LANCL2 antibody (70R-2713)

LANCL2 antibody (70R-2713) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LANCL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LANCL2 is necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LANCL2 antibody (70R-2713) | LANCL2 antibody (70R-2713) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors