LARP1 antibody (70R-4917)

Rabbit polyclonal LARP1 antibody raised against the N terminal of LARP1

Synonyms Polyclonal LARP1 antibody, Anti-LARP1 antibody, LARP 1 antibody, LARP-1, LARP-1 antibody, LARP1, KIAA0731 antibody, La Ribonucleoprotein Domain Family Member 1 antibody, LARP 1, LARP antibody, MGC19556 antibody
Specificity LARP1 antibody was raised against the N terminal of LARP1
Cross Reactivity Human
Applications WB
Immunogen LARP1 antibody was raised using the N terminal of LARP1 corresponding to a region with amino acids HKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKN
Assay Information LARP1 Blocking Peptide, catalog no. 33R-3771, is also available for use as a blocking control in assays to test for specificity of this LARP1 antibody


Western blot analysis using LARP1 antibody (70R-4917)

Recommended LARP1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 116 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LARP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LARP1 belongs to the LARP family and it contains 1 HTH La-type RNA-binding domain. The exact function of LARP1 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using LARP1 antibody (70R-4917) | Recommended LARP1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors