LARP7 antibody (70R-1451)

Rabbit polyclonal LARP7 antibody raised against the C terminal of LARP7

Synonyms Polyclonal LARP7 antibody, Anti-LARP7 antibody, LARP-7 antibody, La Ribonucleoprotein Domain Family Member 7 antibody, LARP-7, LARP 7, LARP7, LARP 7 antibody
Specificity LARP7 antibody was raised against the C terminal of LARP7
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen LARP7 antibody was raised using the C terminal of LARP7 corresponding to a region with amino acids HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL
Assay Information LARP7 Blocking Peptide, catalog no. 33R-3703, is also available for use as a blocking control in assays to test for specificity of this LARP7 antibody


Western Blot analysis using LARP7 antibody (70R-1451)

LARP7 antibody (70R-1451) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LARP7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LARP7 is a negative transcriptional regulator of polymerase II genes, acting by means of the 7SK RNP system. Within the 7SK RNP complex, the positive transcription elongation factor b (P-TEFb) is sequestered in an inactive form, preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LARP7 antibody (70R-1451) | LARP7 antibody (70R-1451) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors