LASP1 Blocking Peptide (33R-8949)

A synthetic peptide for use as a blocking control in assays to test for specificity of LASP1 antibody, catalog no. 70R-2366

Synonyms LASP1 control peptide, LASP1 antibody Blocking Peptide, Anti-LASP1 Blocking Peptide, Lim And Sh3 Protein 1 Blocking Peptide, Lasp-1 Blocking Peptide, MLN50 Blocking Peptide, LASP1, LASP-1, LASP 1, LASP-1 Blocking Peptide, LASP 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVN
Molecular Weight 30 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LASP1 is a member of a LIM protein subfamily characterized by a LIM motif and a domain of Src homology region 3. It functions as an actin-binding protein and possibly in cytoskeletal organization.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors