LASP1 Blocking Peptide (33R-8949)
A synthetic peptide for use as a blocking control in assays to test for specificity of LASP1 antibody, catalog no. 70R-2366
Overview
Overview
| Synonyms | LASP1 control peptide, LASP1 antibody Blocking Peptide, Anti-LASP1 Blocking Peptide, Lim And Sh3 Protein 1 Blocking Peptide, Lasp-1 Blocking Peptide, MLN50 Blocking Peptide, LASP1, LASP-1, LASP 1, LASP-1 Blocking Peptide, LASP 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVN |
|---|---|
| Molecular Weight | 30 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | LASP1 is a member of a LIM protein subfamily characterized by a LIM motif and a domain of Src homology region 3. It functions as an actin-binding protein and possibly in cytoskeletal organization. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product