LAX1 Blocking Peptide (33R-1089)
A synthetic peptide for use as a blocking control in assays to test for specificity of LAX1 antibody, catalog no. 70R-9683
Overview
Overview
| Synonyms | LAX1 control peptide, LAX1 antibody Blocking Peptide, Anti-LAX1 Blocking Peptide, lymphocyte transmembrane adaptor 1 Blocking Peptide, FLJ20340 Blocking Peptide, LAX Blocking Peptide, LAX1, LAX-1, LAX 1, LAX-1 Blocking Peptide, LAX 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | ADFQPFTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGPGTQLL |
|---|---|
| Molecular Weight | 42 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product