LAX1 Blocking Peptide (33R-1089)

A synthetic peptide for use as a blocking control in assays to test for specificity of LAX1 antibody, catalog no. 70R-9683

Synonyms LAX1 control peptide, LAX1 antibody Blocking Peptide, Anti-LAX1 Blocking Peptide, lymphocyte transmembrane adaptor 1 Blocking Peptide, FLJ20340 Blocking Peptide, LAX Blocking Peptide, LAX1, LAX-1, LAX 1, LAX-1 Blocking Peptide, LAX 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADFQPFTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGPGTQLL
Molecular Weight 42 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors