LCA5 antibody (70R-3735)

Rabbit polyclonal LCA5 antibody raised against the N terminal of LCA5

Synonyms Polyclonal LCA5 antibody, Anti-LCA5 antibody, LCA 5, LCA-5 antibody, LCA-5, Leber Congenital Amaurosis 5 antibody, LCA5, C6orf152 antibody, LCA 5 antibody
Specificity LCA5 antibody was raised against the N terminal of LCA5
Cross Reactivity Human
Applications WB
Immunogen LCA5 antibody was raised using the N terminal of LCA5 corresponding to a region with amino acids FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST
Assay Information LCA5 Blocking Peptide, catalog no. 33R-3071, is also available for use as a blocking control in assays to test for specificity of this LCA5 antibody


Western Blot analysis using LCA5 antibody (70R-3735)

LCA5 antibody (70R-3735) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LCA5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LCA5 is a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this gene cause Leber congenital amaurosis type V. Mutations in this gene cause Leber congenital amaurosis type V. Alternative splicing results in two transcript variants.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LCA5 antibody (70R-3735) | LCA5 antibody (70R-3735) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors