LCMT2 antibody (70R-2726)

Rabbit polyclonal LCMT2 antibody raised against the C terminal of LCMT2

Synonyms Polyclonal LCMT2 antibody, Anti-LCMT2 antibody, KIAA0547 antibody, LCMT2, LCMT 2 antibody, PPM2 antibody, Leucine Carboxyl Methyltransferase 2 antibody, LCMT-2 antibody, LCMT 2, LCMT-2, TYW4 antibody, MGC9534 antibody
Specificity LCMT2 antibody was raised against the C terminal of LCMT2
Cross Reactivity Human
Applications WB
Immunogen LCMT2 antibody was raised using the C terminal of LCMT2 corresponding to a region with amino acids PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS
Assay Information LCMT2 Blocking Peptide, catalog no. 33R-7414, is also available for use as a blocking control in assays to test for specificity of this LCMT2 antibody

Images

Western Blot analysis using LCMT2 antibody (70R-2726)

LCMT2 antibody (70R-2726) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 75 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LCMT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LCMT2 belongs to the highly variable methyltransferase superfamily. This gene is the inferred homolog of the Saccharomyces cerevisiae carboxymethyltransferase gene PPM2 that is essential for the synthesis of the hypermodified guanosine Wybutosine (yW).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LCMT2 antibody (70R-2726) | LCMT2 antibody (70R-2726) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors