LDHA antibody (70R-3736)

Rabbit polyclonal LDHA antibody raised against the N terminal of LDHA

Synonyms Polyclonal LDHA antibody, Anti-LDHA antibody, LDH1 antibody, Lactate Dehydrogenase A antibody, PIG19 antibody, LDH-M antibody
Specificity LDHA antibody was raised against the N terminal of LDHA
Cross Reactivity Human
Applications WB
Immunogen LDHA antibody was raised using the N terminal of LDHA corresponding to a region with amino acids ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALV
Assay Information LDHA Blocking Peptide, catalog no. 33R-1565, is also available for use as a blocking control in assays to test for specificity of this LDHA antibody

Images

Western blot analysis using LDHA antibody (70R-3736)

Recommended LDHA Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LDHA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LDHA catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using LDHA antibody (70R-3736) | Recommended LDHA Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using LDHA antibody (70R-3736) | Liver
  • Western blot analysis using LDHA antibody (70R-3736) | LDHA antibody validated by WB using LdhC knockout mouse sperm, LdhA transgenic kidney, IdhA transgenic testis, LdhC knockout testis at 1:1000.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors