LDHA Blocking Peptide (33R-7206)
A synthetic peptide for use as a blocking control in assays to test for specificity of LDHA antibody, catalog no. 70R-3851
Overview
Overview
| Synonyms | LDHA control peptide, LDHA antibody Blocking Peptide, Anti-LDHA Blocking Peptide, Lactate Dehydrogenase A Blocking Peptide, LDH-M Blocking Peptide, LDH1 Blocking Peptide, PIG19 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH |
|---|---|
| Molecular Weight | 37 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | LDHA catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product