LDHA Blocking Peptide (33R-7206)

A synthetic peptide for use as a blocking control in assays to test for specificity of LDHA antibody, catalog no. 70R-3851

Synonyms LDHA control peptide, LDHA antibody Blocking Peptide, Anti-LDHA Blocking Peptide, Lactate Dehydrogenase A Blocking Peptide, LDH-M Blocking Peptide, LDH1 Blocking Peptide, PIG19 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH
Molecular Weight 37 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LDHA catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors