LECT1 Blocking Peptide (33R-1259)

A synthetic peptide for use as a blocking control in assays to test for specificity of LECT1 antibody, catalog no. 70R-6248

Synonyms LECT1 control peptide, LECT1 antibody Blocking Peptide, Anti-LECT1 Blocking Peptide, Leukocyte Cell Derived Chemotaxin 1 Blocking Peptide, BRICD3 Blocking Peptide, CHM-I Blocking Peptide, CHM1 Blocking Peptide, LECT1, LECT-1, LECT 1, LECT-1 Blocking Peptide, LECT 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGK
Molecular Weight 14 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LECT1 is a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The mature protein promotes chondrocyte growth and inhibits angiogenesis. The mature protein likely plays a role in endochondral bone development by permitting cartilaginous anlagen to be vascularized and replaced by bone. It may be involved also in the broad control of tissue vascularization during development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors