LECT1 Blocking Peptide (33R-1259)
A synthetic peptide for use as a blocking control in assays to test for specificity of LECT1 antibody, catalog no. 70R-6248
Overview
Overview
| Synonyms | LECT1 control peptide, LECT1 antibody Blocking Peptide, Anti-LECT1 Blocking Peptide, Leukocyte Cell Derived Chemotaxin 1 Blocking Peptide, BRICD3 Blocking Peptide, CHM-I Blocking Peptide, CHM1 Blocking Peptide, LECT1, LECT-1, LECT 1, LECT-1 Blocking Peptide, LECT 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGK |
|---|---|
| Molecular Weight | 14 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | LECT1 is a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The mature protein promotes chondrocyte growth and inhibits angiogenesis. The mature protein likely plays a role in endochondral bone development by permitting cartilaginous anlagen to be vascularized and replaced by bone. It may be involved also in the broad control of tissue vascularization during development. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product