LEFTY1 Blocking Peptide (33R-6338)
A synthetic peptide for use as a blocking control in assays to test for specificity of LEFTY1 antibody, catalog no. 70R-6222
Overview
Overview
| Synonyms | LEFTY1 control peptide, LEFTY1 antibody Blocking Peptide, Anti-LEFTY1 Blocking Peptide, Left-Right Determination Factor 1 Blocking Peptide, LEFTB Blocking Peptide, LEFTYB Blocking Peptide, LEFTY1, LEFTY-1, LEFTY 1, LEFTY-1 Blocking Peptide, LEFTY 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE |
|---|---|
| Molecular Weight | 11 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | LEFTY1 is a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product