LEFTY1 Blocking Peptide (33R-6338)

A synthetic peptide for use as a blocking control in assays to test for specificity of LEFTY1 antibody, catalog no. 70R-6222

Synonyms LEFTY1 control peptide, LEFTY1 antibody Blocking Peptide, Anti-LEFTY1 Blocking Peptide, Left-Right Determination Factor 1 Blocking Peptide, LEFTB Blocking Peptide, LEFTYB Blocking Peptide, LEFTY1, LEFTY-1, LEFTY 1, LEFTY-1 Blocking Peptide, LEFTY 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE
Molecular Weight 11 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LEFTY1 is a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors