Leptin Blocking Peptide (33R-5033)
A synthetic peptide for use as a blocking control in assays to test for specificity of LEP antibody, catalog no. 70R-6223
Overview
Overview
| Synonyms | Leptin control peptide, Leptin antibody Blocking Peptide, Anti-Leptin Blocking Peptide, OB Blocking Peptide, OBS Blocking Peptide, LEP Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM |
|---|---|
| Molecular Weight | 16 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product