Leptin Blocking Peptide (33R-6105)
A synthetic peptide for use as a blocking control in assays to test for specificity of LEP antibody, catalog no. 70R-6221
Overview
Overview
| Synonyms | Leptin control peptide, Leptin antibody Blocking Peptide, Anti-Leptin Blocking Peptide, OB Blocking Peptide, OBS Blocking Peptide, LEP Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
|---|---|
| Molecular Weight | 16 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product