Leptin Blocking Peptide (33R-6105)

A synthetic peptide for use as a blocking control in assays to test for specificity of LEP antibody, catalog no. 70R-6221

Synonyms Leptin control peptide, Leptin antibody Blocking Peptide, Anti-Leptin Blocking Peptide, OB Blocking Peptide, OBS Blocking Peptide, LEP Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS
Molecular Weight 16 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors