LHPP Blocking Peptide (33R-1067)

A synthetic peptide for use as a blocking control in assays to test for specificity of LHPP antibody, catalog no. 70R-4027

Synonyms LHPP control peptide, LHPP antibody Blocking Peptide, Anti-LHPP Blocking Peptide, Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase Blocking Peptide, MGC117251 Blocking Peptide, MGC142189 Blocking Peptide, MGC142191 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM
Molecular Weight 29 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LHPP protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors