LINGO4 Blocking Peptide (33R-9169)
A synthetic peptide for use as a blocking control in assays to test for specificity of LINGO4 antibody, catalog no. 70R-6498
Overview
Overview
| Synonyms | LINGO4 control peptide, LINGO4 antibody Blocking Peptide, Anti-LINGO4 Blocking Peptide, Leucine Rich Repeat And Ig Domain Containing 4 Blocking Peptide, DAAT9248 Blocking Peptide, LRRN6D Blocking Peptide, PRO34002 Blocking Peptide, LINGO4, LINGO-4, LINGO 4, LINGO-4 Blocking Peptide, LINGO 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT |
|---|---|
| Molecular Weight | 64 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of LINGO4 protein has not been widely studied, and is yet to be fully elucidated. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product