LIPH Blocking Peptide (33R-10361)

A synthetic peptide for use as a blocking control in assays to test for specificity of LIPH antibody, catalog no. 70R-10356

Synonyms LIPH control peptide, LIPH antibody Blocking Peptide, Anti-LIPH Blocking Peptide, lipase, member H Blocking Peptide, AH Blocking Peptide, LPDLR Blocking Peptide, PLA1B Blocking Peptide, mPA-PLA1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADNWKDHLRG
Molecular Weight 50 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a membrane-bound member of the mammalian triglyceride lipase family. It catalyzes the production of 2-acyl lysophosphatidic acid (LPA), which is a lipid mediator with diverse biological properties that include platelet aggregation, smooth muscle contraction, and stimulation of cell proliferation and motility.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors