Lipin 1 antibody (70R-3204)

Rabbit polyclonal Lipin 1 antibody raised against the N terminal of LPIN1

Synonyms Polyclonal Lipin 1 antibody, Anti-Lipin 1 antibody, LPIN1 antibody, DKFZp781P1796 antibody, Lipin -1, KIAA0188 antibody, Lipin 1, Lipin -1 antibody, Lipin 1 antibody, Lipin 1
Specificity Lipin 1 antibody was raised against the N terminal of LPIN1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Lipin 1 antibody was raised using the N terminal of LPIN1 corresponding to a region with amino acids SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK
Assay Information Lipin 1 Blocking Peptide, catalog no. 33R-8579, is also available for use as a blocking control in assays to test for specificity of this Lipin 1 antibody


Western blot analysis using Lipin 1 antibody (70R-3204)

Recommended LPIN1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LPIN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that LPIN1 functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using Lipin 1 antibody (70R-3204) | Recommended LPIN1 Antibody Titration: 0.2-1 ug/ml
  • Immunofluorescent staining using Lipin 1 antibody (70R-3204) | Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytes stained with Lipin 1 antibody at 1:100

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors