Lipocalin 12 antibody (70R-5485)

Rabbit polyclonal Lipocalin 12 antibody raised against the N terminal of LCN12

Synonyms Polyclonal Lipocalin 12 antibody, Anti-Lipocalin 12 antibody, MGC34753 antibody, Lipocalin 12, Lipocalin 12 antibody, MGC48935 antibody, LCN12 antibody, Lipocalin -12, Lipocalin 12, Lipocalin -12 antibody
Specificity Lipocalin 12 antibody was raised against the N terminal of LCN12
Cross Reactivity Human
Applications WB
Immunogen Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG
Assay Information Lipocalin 12 Blocking Peptide, catalog no. 33R-3454, is also available for use as a blocking control in assays to test for specificity of this Lipocalin 12 antibody

Images

Western Blot analysis using Lipocalin 12 antibody (70R-5485)

Lipocalin 12 antibody (70R-5485) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LCN12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Lipocalin 12 antibody (70R-5485) | Lipocalin 12 antibody (70R-5485) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors