Lipocalin 8 antibody (70R-3225)

Rabbit polyclonal Lipocalin 8 antibody raised against the N terminal of LCN8

Synonyms Polyclonal Lipocalin 8 antibody, Anti-Lipocalin 8 antibody, Lipocalin -8 antibody, Lipocalin 8, Lipocalin 8, LCN8 antibody, Lipocalin 8 antibody, EP17 antibody, LCN5 antibody, Lipocalin -8
Specificity Lipocalin 8 antibody was raised against the N terminal of LCN8
Cross Reactivity Human
Applications WB
Immunogen Lipocalin 8 antibody was raised using the N terminal of LCN8 corresponding to a region with amino acids EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN
Assay Information Lipocalin 8 Blocking Peptide, catalog no. 33R-2370, is also available for use as a blocking control in assays to test for specificity of this Lipocalin 8 antibody

Images

Western Blot analysis using Lipocalin 8 antibody (70R-3225)

Lipocalin 8 antibody (70R-3225) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LCN8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the lipocalin family, such as LCN8, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Lipocalin 8 antibody (70R-3225) | Lipocalin 8 antibody (70R-3225) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors