LIPT1 Blocking Peptide (33R-6654)
A synthetic peptide for use as a blocking control in assays to test for specificity of LIPT1 antibody, catalog no. 70R-2759
Overview
Overview
| Synonyms | LIPT1 control peptide, LIPT1 antibody Blocking Peptide, Anti-LIPT1 Blocking Peptide, Lipoyltransferase 1 Blocking Peptide, MGC12290 Blocking Peptide, MGC13378 Blocking Peptide, LIPT1, LIPT-1, LIPT 1, LIPT-1 Blocking Peptide, LIPT 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE |
|---|---|
| Molecular Weight | 42 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, LIPT1 transfers the lipoyl moiety to apoproteins. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product