LIPT1 Blocking Peptide (33R-6654)

A synthetic peptide for use as a blocking control in assays to test for specificity of LIPT1 antibody, catalog no. 70R-2759

Synonyms LIPT1 control peptide, LIPT1 antibody Blocking Peptide, Anti-LIPT1 Blocking Peptide, Lipoyltransferase 1 Blocking Peptide, MGC12290 Blocking Peptide, MGC13378 Blocking Peptide, LIPT1, LIPT-1, LIPT 1, LIPT-1 Blocking Peptide, LIPT 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE
Molecular Weight 42 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, LIPT1 transfers the lipoyl moiety to apoproteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors