LMAN2 antibody (70R-7314)

Rabbit polyclonal LMAN2 antibody raised against the N terminal of LMAN2

Synonyms Polyclonal LMAN2 antibody, Anti-LMAN2 antibody, LMAN 2 antibody, LMAN-2, LMAN2, LMAN 2, C5orf8 antibody, Lectin Mannose-Binding 2 antibody, VIP36 antibody, LMAN-2 antibody, GP36B antibody
Specificity LMAN2 antibody was raised against the N terminal of LMAN2
Cross Reactivity Human,Mouse,Dog
Applications IHC, WB
Immunogen LMAN2 antibody was raised using the N terminal of LMAN2 corresponding to a region with amino acids SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF
Assay Information LMAN2 Blocking Peptide, catalog no. 33R-8595, is also available for use as a blocking control in assays to test for specificity of this LMAN2 antibody


Immunohistochemical staining using LMAN2 antibody (70R-7314)

LMAN2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LMAN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using LMAN2 antibody (70R-7314) | LMAN2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using LMAN2 antibody (70R-7314) | LMAN2 antibody (70R-7314) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using LMAN2 antibody (70R-7314) | LMAN2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors